DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG31205

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:242 Identity:56/242 - (23%)
Similarity:82/242 - (33%) Gaps:71/242 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IVALRFDNGNGGGWYCGGSIIGHEWVLTAAHCTYGASYVTISYGAVWRQQPQFTHYDTGNLH--- 112
            ||.:..|..|  ...|.|.:|....|:|||||.......:| ||.|      |...|:.|::   
  Fly    55 IVGVTKDGSN--TLLCTGILIDSRRVVTAAHCVSKDESESI-YGVV------FGDSDSSNINLVS 110

  Fly   113 --------------NDIALIR-TPHVDFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSG 162
                          ||:|:|. |..|.|..||..:.||...:...            ||.:.:|.
  Fly   111 AVTVHPDYSPRKFENDLAIIELTKEVVFSDLVQPICLPSVSEMVP------------GSETSNSK 163

  Fly   163 M----------------TDYLNCVDIQISDNSVCLDYYGSH----YITSNHLCYAT---PENKGS 204
            :                |..|   |.:|......:|....|    ......:|..|   |.:..:
  Fly   164 LIVAGLEGPSFDRRHSATQRL---DKRIKMTYTKIDSKECHEKQARFPEELICGHTERSPLSGSA 225

  Fly   205 CSGDSGGPLVLHDGNRQVGIVSFGSAAGCLSNSPKGLTRVTGYLDWI 251
            .:..||.|...|    .:||...|..:..|.:  :|...:..:||||
  Fly   226 LTEASGTPRQFH----LLGIAVAGFFSSDLDH--QGYLNIRPHLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 54/240 (23%)
Tryp_SPc 37..254 CDD:238113 56/242 (23%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 34/133 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.