DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and spirit

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:302 Identity:74/302 - (24%)
Similarity:113/302 - (37%) Gaps:90/302 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FSAFALVAALERPVPVK-DMPAGNKING------------RITNGYPAYEGKVPYIVALRFDNGN 60
            |..:...|....|:..: ...|.|::|.            .:..|.|....:.|::.||      
  Fly    91 FDHYVCCAPAVAPIVTRSSQQACNELNKVSKVKEIDEFFVSVVGGMPTRPREFPFMAAL------ 149

  Fly    61 GGGW----------YCGGSIIGHEWVLTAAHCT-----------YGASYVTISYGAVWRQQPQFT 104
              ||          .|||::|.:.:|||||||.           .|...:|::.|.....:....
  Fly   150 --GWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDNLTLTEGEDISIRRVII 212

  Fly   105 H--YDTGNLHNDIALIR-----TPHVD---FW-------SLVNKVELPRYDDRYNNFYGWWALLS 152
            |  |.....:|||||:.     .|.:.   .|       :||..:                    
  Fly   213 HPDYSASTAYNDIALLELETAAKPELKPTCIWTQKEVTNTLVTAI-------------------- 257

  Fly   153 GWGSSSDSSGMTDYLNCVDIQISDNSVCLDYYG----SHYITSNHLCYA--TPENKGSCSGDSGG 211
            |:|.:|.:...:..|..|.::...|..|..:|.    :..:....:|..  |.| :.:|.|||||
  Fly   258 GYGQTSFAGLSSAQLLKVPLKSVSNEECQHHYQKDQLAQGVLGTQMCAGDITGE-RDTCQGDSGG 321

  Fly   212 PLVLHDG--NRQVGIVSFGSAAGCLSNSPKGLTRVTGYLDWI 251
            ||::.||  ...|||.|.|.  ||.|..|...|||:.::|||
  Fly   322 PLLMQDGLLGYVVGITSLGQ--GCASGPPSVYTRVSSFVDWI 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 66/260 (25%)
Tryp_SPc 37..254 CDD:238113 68/261 (26%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829 1/6 (17%)
Tryp_SPc 132..364 CDD:238113 68/261 (26%)
Tryp_SPc 132..361 CDD:214473 66/259 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436959
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.