DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and Mcpt2

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_742041.1 Gene:Mcpt2 / 29266 RGDID:621058 Length:247 Species:Rattus norvegicus


Alignment Length:264 Identity:77/264 - (29%)
Similarity:110/264 - (41%) Gaps:47/264 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLFSAFALVAALERPVPVKDMPAGNKINGRITNGYPAYEGKVPYIVALRFDNGNGGGWYCGGSII 71
            |||    |:|.|        :|:|.... .|..|..:.....||:..|......|....|||.:|
  Rat     4 LLF----LMALL--------LPSGAGAE-EIIGGVESIPHSRPYMAHLDIVTEKGLRVICGGFLI 55

  Fly    72 GHEWVLTAAHCTYGASYVTISYGA--------------VWRQQPQFTHYDTGNLHNDIALIRTPH 122
            ..::|||||||.  ...:|:..||              |.:|....::....|||:.:.|.....
  Rat    56 SRQFVLTAAHCK--GREITVILGAHDVRKRESTQQKIKVEKQIIHESYNSVPNLHDIMLLKLEKK 118

  Fly   123 VDFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDNSVCLDYYGSH 187
            |:....||.|.||...|..:.....||  :|||.:......:..|..|:::|.|...|:||  .:
  Rat   119 VELTPAVNVVPLPSPSDFIHPGAMCWA--AGWGKTGVRDPTSYTLREVELRIMDEKACVDY--RY 179

  Fly   188 YITSNHLCYATPEN-KGSCSGDSGGPL----VLHDGNRQVGIVSFGSAAGCLSNSPKGLTRVTGY 247
            |.....:|..:|.. :.:..|||||||    |.|      ||||:|...   :..|...|||:.|
  Rat   180 YEYKFQVCVGSPTTLRAAFMGDSGGPLLCAGVAH------GIVSYGHPD---AKPPAIFTRVSTY 235

  Fly   248 LDWI 251
            :.||
  Rat   236 VPWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 67/233 (29%)
Tryp_SPc 37..254 CDD:238113 69/234 (29%)
Mcpt2NP_742041.1 Tryp_SPc 20..239 CDD:214473 67/233 (29%)
Tryp_SPc 21..242 CDD:238113 69/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.