DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG33462

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:288 Identity:66/288 - (22%)
Similarity:118/288 - (40%) Gaps:60/288 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLGVLLFSAFALVAALERPVP------VKDMPAGNKINGRITNGYPAYEGKVPYIVALRFDNGNG 61
            ::|:      |::..|.|.|.      .:|....:.|:.|..|...|....:.|:...:      
  Fly     5 IIGI------AVICCLWRRVQGFQMLLEEDCGIPHNISERSVNAKLAQNPWMAYLETPK------ 57

  Fly    62 GGWYCGGSIIGHEWVLTAAHCTYGASYVTISYGAV-----------WRQQP--------QFTH-- 105
             |::|.|::|.|.:|||||||......:|:..|..           ..|:|        .|.|  
  Fly    58 -GFHCSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRY 121

  Fly   106 YDTGNLHNDIALIRT-PHVDFWSLVNKVEL---PRYDDRYNNFYGWWALLSGWGSSSDSSGMTDY 166
            |:..:..|||.::|. ..|::.:.:..:.:   .|:.:..:..  .|...:.|..:: ::..:..
  Fly   122 YNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQL--TWFTTTVWRETA-ANATSKV 183

  Fly   167 LNCVDIQISDNSVCLDYYGSHYITSNHLCYATPENKGSCSGDSGGPLV---LHDGNR---QVGIV 225
            |..::|.......|.:.||.: :|...:|.....:: .||.|||.|.:   .|:|:.   |:||.
  Fly   184 LRTMNIDRQPKETCSEIYGWN-MTFEQICAGNTLSQ-LCSTDSGAPQIRKMWHNGSDRYVQLGIA 246

  Fly   226 SFGSAAGCLSNSPKG-LTRVTGYLDWIR 252
            |  ...|...||  | |..:..|.|||:
  Fly   247 S--RVKGQCQNS--GILMDLLSYADWIK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 57/246 (23%)
Tryp_SPc 37..254 CDD:238113 58/248 (23%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 56/239 (23%)
Tryp_SPc 48..269 CDD:214473 54/236 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435646
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.