DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG33461

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:260 Identity:69/260 - (26%)
Similarity:105/260 - (40%) Gaps:56/260 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KINGRITNGYPAYEGKVPYIVALRFDNGNGGGWYCGGSIIGHEWVLTAAHCTYGASYVTISYGAV 96
            :::.:|.||.||..|:.|::..|....    .:.|.||:|...:|||:|||......:....|..
  Fly    37 RLSYKIINGTPARLGRYPWMAFLHTPT----YFLCAGSLINQWFVLTSAHCIEDDVELIARLGEN 97

  Fly    97 WRQQP-------------------QFTH--YDTGNLHNDIALIR-------TPHVDFWSLVNKVE 133
            .|...                   .|.|  ||..:..|||.::|       |.|:....:.:...
  Fly    98 NRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFSNDIGMLRLERRVEYTYHIQPICIFHHRR 162

  Fly   134 LPRYDDRYNNFYGWWALLSGWG-SSSD----SSGMTDYLNCVDIQISDNSVCLDYYGSHYITSNH 193
            :....|:..     |...:||| :|:|    ||.:...||......:|   |...:..::: |..
  Fly   163 MQLVVDQIT-----WFKATGWGLTSTDLNTKSSRVLMELNLYRRPRND---CARIFKQNFL-SGQ 218

  Fly   194 LCYATPENKGSCSGDSGGP---LVLHDGNR---QVGIVSFGSAAGCLSNSPKGLTRVTGYLDWIR 252
            :| |..::...|.||||||   .||..|.:   |:||.|| :...|...|.  ||.|..|..||:
  Fly   219 IC-AGNDDGNLCRGDSGGPQGRYVLIFGMKRFVQMGIASF-TYENCSKVSI--LTDVVRYGRWIK 279

  Fly   253  252
              Fly   280  279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 67/253 (26%)
Tryp_SPc 37..254 CDD:238113 69/255 (27%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 67/253 (26%)
Tryp_SPc 42..281 CDD:238113 69/255 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435647
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.