DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG30323

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:204 Identity:43/204 - (21%)
Similarity:63/204 - (30%) Gaps:65/204 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GGGWYCGGSIIGHEWVLTAAHCTYGASYVTISYGAVWRQQPQFTHYDTGNLHNDIALIRTP---- 121
            |...:|.||::...||:|:..|.              ..:|:.|.....|..|...::.||    
  Fly    49 GDNHFCAGSLLSAWWVVTSGCCV--------------STRPESTPNQPSNRKNLRVVVFTPKRLK 99

  Fly   122 --------HVDFWSL-------VNKVELPRYD-----DRYNNFYGWWALLSGWGSSSDSSGMTDY 166
                    ||....|       ..::.|.:.|     .|:........|.|.|..:|...|...|
  Fly   100 KPSPKNIYHVQKIVLDESAISGCTELALLKLDRGVTGQRFAMMLPEKELNSTWLCNSLGWGRIYY 164

  Fly   167 LNCVDI--------QISDNSVCL---DYYGSHYI---------------TSNHLCYATPENKGS- 204
            ::.|.|        .:.||.|..   ..|.|..|               .|..||..:...:|: 
  Fly   165 VSYVYISAMCPAFSMVYDNPVTWFQDGPYSSELIQIRAQKISEYECKPDCSRCLCMTSYTGRGNM 229

  Fly   205 CSGDSGGPL 213
            |..|.|.||
  Fly   230 CQQDLGSPL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 43/204 (21%)
Tryp_SPc 37..254 CDD:238113 43/204 (21%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 43/204 (21%)
Tryp_SPc 45..272 CDD:214473 43/204 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471252
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.