DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG30286

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:247 Identity:67/247 - (27%)
Similarity:103/247 - (41%) Gaps:53/247 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YPAYEGKVPYIVALRFDNGNGGGWYCGGSIIGHEWVLTAAHCTYGASYVTISYGAV--------- 96
            :.|:..:.|::..|.    ..|...|||:::.|.::||||||......:|:..|..         
  Fly    39 HQAHISESPWMAYLH----KSGELVCGGTLVNHRFILTAAHCIREDENLTVRLGEFNSLTSIDCN 99

  Fly    97 ----------WRQQPQFTH--YDTGNLHNDIALIRTP-------HVDFWSLVNKVELPRYDDRYN 142
                      :.....|.|  |...|..:||.|:|..       |:....|:....|....:|.:
  Fly   100 GSDCLPPSEDFEIDVAFRHGGYSRTNRIHDIGLLRLAKSVEYKVHIKPICLITNTTLQPKIERLH 164

  Fly   143 NFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDNSVCLDYYGSHYI--TSNHLCYATPENKGSC 205
            ..     :.:||| .|.|......|..:.:...:..||...|   ::  ..:.:| .:.|:..||
  Fly   165 RL-----VATGWG-RSPSEAANHILKSIRVTRVNWGVCSKTY---WVDRRRDQIC-VSHESGVSC 219

  Fly   206 SGDSGGPL---VLHDGN---RQVGIVSFGSAAGCLSNSPKGLTRVTGYLDWI 251
            |||||||:   :..||.   .||||||:|:|. ||  ||...|.|..::|||
  Fly   220 SGDSGGPMGQAIRLDGRVLFVQVGIVSYGNAE-CL--SPSVFTNVMEHIDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 65/245 (27%)
Tryp_SPc 37..254 CDD:238113 67/247 (27%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 67/247 (27%)
Tryp_SPc 39..268 CDD:214473 65/245 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435642
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.