DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG30098

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:260 Identity:64/260 - (24%)
Similarity:101/260 - (38%) Gaps:84/260 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RITNGYPAYEGKVPYIVALRFDNGNGGGWYCGGSIIGHEWVLTAAHCT------------YGASY 88
            |:..|..|  .:.|::..|..||    .:.||||:|.:.:||||||||            |.:|.
  Fly    36 RVIGGQNA--RRTPWMAYLIRDN----RFACGGSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSR 94

  Fly    89 VTISYGAVWRQQPQFTHYDTGNLHN-DIALIRTP----------------HVDFWSLVNKVELPR 136
            .|......:|....:.|.:..:..| |||:::..                :....||.|.::   
  Fly    95 TTDGQTRSYRVVSIYRHKNYIDFRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQ--- 156

  Fly   137 YDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDNSVCLDYYGSHYITSNHLCYATPEN 201
                  ||     .|:|||..:....|...|..:.::...|..|       .:.|..:|...|. 
  Fly   157 ------NF-----TLTGWGQMAHYYKMPTTLQEMSLRRVRNEYC-------GVPSLSICCWNPV- 202

  Fly   202 KGSCSGDSGGPL--VLHDGNRQVGIVSFGSAAGCLSNSPKGLTRVTG-------------YLDWI 251
            :.:|.|||||||  ::..|::.: .|.||     ::||      |||             |:.|:
  Fly   203 QYACFGDSGGPLGSLVKYGHKTI-YVQFG-----VTNS------VTGNCDGYSSYLDLMSYMPWL 255

  Fly   252  251
              Fly   256  255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 63/258 (24%)
Tryp_SPc 37..254 CDD:238113 63/259 (24%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 63/257 (25%)
Tryp_SPc 37..258 CDD:238113 63/259 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435655
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.