DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG30090

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:268 Identity:76/268 - (28%)
Similarity:108/268 - (40%) Gaps:75/268 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NKINGRITNGYPAYEGKVPYIVALRFDNGNGGGWYCGGSIIGHEWVLTAAHCTYGASYVTISYG- 94
            |.|..:|..|..|.....|::..:.    :.....|||::|...:|||||||....|.|.:..| 
  Fly    34 NTIAFKIIGGRDAIINSNPWMAYIH----SSVKLICGGTLITQRFVLTAAHCVNEGSAVKVRLGE 94

  Fly    95 -------------AVWRQQPQ-----FTH---YDTGNLHNDIALIR-TPHVDFWS---------- 127
                         .:.|.:..     |.|   .:..|| |||||:| ...|.|.:          
  Fly    95 YDDTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNL-NDIALLRLAKFVTFKAHISPICIILG 158

  Fly   128 -----LVNKVELPRYDDRYNNFYGWWALLSGWGSSSD--SSGMTDYLNCVDIQISDNSVCLDYYG 185
                 ||:.:|              |.:.:|||.:..  :.|:   |....:|..::|.|:...|
  Fly   159 TSKRELVDSIE--------------WFVATGWGETRTHRTRGV---LQITQLQRYNSSQCMQALG 206

  Fly   186 SHYITSNHLCYATPENKGSCSGDSGGPL---VLH-DGNR--QVGIVSFGSAAGCLSNSPKGL-TR 243
             ..:..|.:| |......:|:|||||||   |.| |..|  |.|:||:||.. |   |..|: |.
  Fly   207 -RLVQQNQIC-AGRLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRE-C---SGIGVYTD 265

  Fly   244 VTGYLDWI 251
            |..|.|||
  Fly   266 VYSYADWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 72/261 (28%)
Tryp_SPc 37..254 CDD:238113 74/262 (28%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 72/261 (28%)
Tryp_SPc 40..276 CDD:238113 74/262 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435636
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.