Sequence 1: | NP_648014.1 | Gene: | Jon65Aii / 38684 | FlyBaseID: | FBgn0035666 | Length: | 259 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_725487.1 | Gene: | CG30090 / 246448 | FlyBaseID: | FBgn0050090 | Length: | 291 | Species: | Drosophila melanogaster |
Alignment Length: | 268 | Identity: | 76/268 - (28%) |
---|---|---|---|
Similarity: | 108/268 - (40%) | Gaps: | 75/268 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 NKINGRITNGYPAYEGKVPYIVALRFDNGNGGGWYCGGSIIGHEWVLTAAHCTYGASYVTISYG- 94
Fly 95 -------------AVWRQQPQ-----FTH---YDTGNLHNDIALIR-TPHVDFWS---------- 127
Fly 128 -----LVNKVELPRYDDRYNNFYGWWALLSGWGSSSD--SSGMTDYLNCVDIQISDNSVCLDYYG 185
Fly 186 SHYITSNHLCYATPENKGSCSGDSGGPL---VLH-DGNR--QVGIVSFGSAAGCLSNSPKGL-TR 243
Fly 244 VTGYLDWI 251 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Jon65Aii | NP_648014.1 | Tryp_SPc | 36..251 | CDD:214473 | 72/261 (28%) |
Tryp_SPc | 37..254 | CDD:238113 | 74/262 (28%) | ||
CG30090 | NP_725487.1 | Tryp_SPc | 39..273 | CDD:214473 | 72/261 (28%) |
Tryp_SPc | 40..276 | CDD:238113 | 74/262 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45435636 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24260 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |