DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG30088

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:251 Identity:74/251 - (29%)
Similarity:104/251 - (41%) Gaps:55/251 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RITNGYPAYEGKVPYIVALRFDNGNGGGWYCGGSIIGHEWVLTAAHCTYGASYVTISYGA--VWR 98
            ||..|..|.....|::..|.:.:    ..:|||:||...::||||||.  ..|:.:..|.  :.|
  Fly    44 RIVRGKEAMLKSAPFMAYLYYSS----EIHCGGTIISSRYILTAAHCM--RPYLKVRLGEHDITR 102

  Fly    99 Q--------QPQFTHYD----------TGNLHNDIALIR-------TPHVD-FWSLVNKVELPRY 137
            .        .|....:|          ...|.|||||::       ..|:. ...::|....|  
  Fly   103 NPDCQGGSCSPPAEEFDIVLATKYKRFDRFLANDIALLKLSRNIRFNVHIQPICLILNPAAAP-- 165

  Fly   138 DDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDNSVCLDYYGSHYITSNHLCYATPENK 202
                 |.:.:.|.  ||| .::::...:.|....:...||..|.... |..||.|.||... :..
  Fly   166 -----NVHEFQAF--GWG-QTETNHSANVLQTTVLTRYDNRHCRSVL-SMPITINQLCVGF-QGS 220

  Fly   203 GSCSGDSGGPLVL---HDG---NRQVGIVSFGSAAGCLSNSPKGLTRVTGYLDWIR 252
            .:||||||||||.   :||   ..|:||||||... |  .||...|.|..|:.|||
  Fly   221 DTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDK-C--QSPGVYTYVPNYIRWIR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 71/248 (29%)
Tryp_SPc 37..254 CDD:238113 73/250 (29%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 71/248 (29%)
Tryp_SPc 45..273 CDD:238113 71/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435643
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.