DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG30083

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:238 Identity:66/238 - (27%)
Similarity:121/238 - (50%) Gaps:31/238 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 INGRITNGYPAYEGKVPYIVAL-RFDNGNGGGWYCGGSIIGHEWVLTAAHCTYGASYVTISYG-- 94
            |:.:|.:|..|..|..|::..: ::::.......|||::|..::||:||||......:.:..|  
  Fly    30 ISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCIKRDQILAVRLGEH 94

  Fly    95 ---------AVWRQQPQFTHYDTGNLHNDIALIR-TPHVDFWSLVNKVELPRYDDRYNNFYGWWA 149
                     ..:|.:    ::.||:..|||.::| .|.|.|.:::..:.:.....:..|...:.|
  Fly    95 SSSRYFAVTKAFRNK----YFTTGSYSNDIGILRIQPIVKFNAVIRPICIITDPTKVPNVKTFKA 155

  Fly   150 LLSGWGSSSDSSGMTDYLNCVDIQISDNSVCLDYYGSHYITSNHLCYATPENKGSCSGDSGGPL- 213
              :|||.:.:.: .:..|..|::...:.|.|.:....: :|.:.:|...|:. .:|:||||||| 
  Fly   156 --AGWGKTENET-FSKVLKTVELNELNASECYNMLWVN-VTESQICAGHPDG-DTCAGDSGGPLI 215

  Fly   214 --VLHDGNR---QVGIVSFGSAAGCLSNSPKGLTRVTGYLDWI 251
              |..||:.   |:||:||||:   |.|||...||::.::|||
  Fly   216 HPVYMDGSLRYVQLGIISFGSS---LCNSPGVYTRLSSFIDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 63/233 (27%)
Tryp_SPc 37..254 CDD:238113 65/234 (28%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 63/233 (27%)
Tryp_SPc 34..255 CDD:238113 63/232 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435635
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.