DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and Klk1b3

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_113711.1 Gene:Klk1b3 / 24594 RGDID:3175 Length:265 Species:Rattus norvegicus


Alignment Length:250 Identity:66/250 - (26%)
Similarity:105/250 - (42%) Gaps:36/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 AGNKINGRITNGYPAYEGKVPYIVALRFDNGNGGGWYCGGSIIGHEWVLTAAHCTYGASYVTISY 93
            |...:..|:..||.......|:.||:.:    .|.:.|||.:|...||:|||||......|.:..
  Rat    21 AAPPVQSRVVGGYNCEMNSQPWQVAVYY----FGEYLCGGVLIDPSWVITAAHCATDNYQVWLGR 81

  Fly    94 GAVWRQQP----------------------QFTHYDTGNLHNDIALIR-TPHVDFWSLVNKVELP 135
            ..::..:|                      ..|.....:..||:.|:. :...|....|..::||
  Rat    82 NNLYEDEPFAQHRLVSQSFPHPGFNQDLIWNHTRQPGDDYSNDLMLLHLSQPADITDGVKVIDLP 146

  Fly   136 RYDDRYNNFYGWWALLSGWGS-SSDSSGMTDYLNCVDIQISDNSVCLDYYGSHYITSNHLCYATP 199
            ..:.:    .|...|.||||| :.|...::|.|.||:|.:..|..|::.: ...:|...||....
  Rat   147 IEEPK----VGSTCLASGWGSITPDGLELSDDLQCVNIDLLSNEKCVEAH-KEEVTDLMLCAGEM 206

  Fly   200 E-NKGSCSGDSGGPLVLHDGNRQVGIVSFGSAAGCLSNSPKGLTRVTGYLDWIRD 253
            : .|.:|.|||||||:. :|..| ||.|:|.........|...|::..:..||::
  Rat   207 DGGKDTCKGDSGGPLIC-NGVLQ-GITSWGFNPCGEPKKPGIYTKLIKFTPWIKE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 63/239 (26%)
Tryp_SPc 37..254 CDD:238113 64/241 (27%)
Klk1b3NP_113711.1 Tryp_SPc 28..257 CDD:214473 63/239 (26%)
Tryp_SPc 29..260 CDD:238113 64/241 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.