DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and try-5

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_505421.3 Gene:try-5 / 187088 WormBaseID:WBGene00006623 Length:327 Species:Caenorhabditis elegans


Alignment Length:290 Identity:72/290 - (24%)
Similarity:106/290 - (36%) Gaps:99/290 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FSAFALVAALERPVPVKDMPAGNKINGRITNGYPAYEGKVPYIVALRFDNGNGG-GWYCGGSIIG 72
            :::|.|..|           |||       .|.|.:  ..|:.|.:|.....|. ...|||::|.
 Worm    35 YTSFMLTDA-----------AGN-------TGNPTH--LAPWAVQIRVKARKGDFEVICGGTLIT 79

  Fly    73 HEWVLTAAHC---TYGA-----------------------------SYVTI---------SYGAV 96
            .:.|||||||   .:||                             :.||:         .||.|
 Worm    80 LKHVLTAAHCFQKHFGAKKEGGEENSMSGRYCESNQRFTDSEILTRTVVTVGAMCTRLEQKYGCV 144

  Fly    97 WRQQ-------PQF-------THYDTGNLHNDIALIRTPHVDFWSLVNKVELPRYD-----DRYN 142
            ..:|       .:|       ||.:.|   |||.::     :..|.::.||...|.     ...|
 Worm   145 NEKQNGKTLKISRFAIGDFYKTHCEQG---NDIVIL-----ELESTIDDVEGANYACLPFLPEVN 201

  Fly   143 NFYGWWALLSGWGSSS----DSSGMTDYLNCVDIQISDNSVCLDYYGSHYITSNHLCYATPENKG 203
            ...|......||||..    |::.. ..:..:.:.....:.|.:.:|:. |..:..|.|..|:|.
 Worm   202 IQSGANVTSFGWGSDPGKGFDNAAF-PMIQVLTLATETLATCEENWGTS-IPFDSFCTAEEEDKN 264

  Fly   204 SCSGDSGGPLVLH--DGNRQ--VGIVSFGS 229
            .|||||||.|..|  |..|:  :.|||:||
 Worm   265 VCSGDSGGGLTFHQSDSAREFIIAIVSYGS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 66/263 (25%)
Tryp_SPc 37..254 CDD:238113 66/262 (25%)
try-5NP_505421.3 Tryp_SPc 48..296 CDD:389826 66/259 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.