DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and try-4

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:299 Identity:68/299 - (22%)
Similarity:104/299 - (34%) Gaps:110/299 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 EGKV---PYIVALRFDNGNGGGWYCGGSIIGHEWVLTAAHCTYGASYVT---------------- 90
            |.|:   |:.|:...|..|    ..|||||....::||||     .::|                
 Worm    52 ESKIKNFPWAVSFTVDGVN----RLGGSIISPYHIITAAH-----GFITTIGSRGNLCENKNWKK 107

  Fly    91 -----------------ISYGAV--------WRQQPQFTHYDTGNLHN----------------- 113
                             ::||..        :...|:....|.  :||                 
 Worm   108 PNSSIYRSIKFLRDTRKVAYGGTCIRGHTDKYPNDPRCKKSDV--IHNKVRAVLVDGEFASSNCL 170

  Fly   114 ---DIALIRT-PHVDFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQI 174
               |.|::.. ..:.|...|..:.||    |.|.:|.....:.|||.|...:.....::.:.::|
 Worm   171 KGHDWAIVEVEKRIHFSENVRPICLP----RPNMYYTKSLAVPGWGRSYIFNESGPLIHEIPMRI 231

  Fly   175 ---------------SDNSVCLDYYGSHYITSNHLCYATPENKGSCSGDSGGPLVLHDGNR---- 220
                           :|:.:|    .:....||   |:.|.   :|.|||||.|...|.|.    
 Worm   232 DRDCKRPWSDRLPADADDFIC----ATSMNVSN---YSAPR---TCHGDSGGGLEYRDDNYGRAF 286

  Fly   221 QVGIVSFGSAAGCLSNSPKGLTRVTGYLDWIRDHTGISY 259
            .:.|.|||: .||.||.....|||..||:.|.::||:.|
 Worm   287 LIAITSFGT-RGCPSNMLARFTRVDMYLNLICNYTGVCY 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 64/289 (22%)
Tryp_SPc 37..254 CDD:238113 65/292 (22%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 65/291 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.