DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and Tpsb2

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:283 Identity:91/283 - (32%)
Similarity:127/283 - (44%) Gaps:57/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLFSAFALVAALERPVPVKDMPAGNKINGRITNGYPAYEGKVPYIVALRFDNGNGGGW--YCGG 68
            :||..|.:|:|:|....|   .||..::.  |..|:.|.|.|.|:.|:|||....   |  :|||
Mouse     6 LLLLWALSLLASLVYSAP---RPANQRVG--IVGGHEASESKWPWQVSLRFKLNY---WIHFCGG 62

  Fly    69 SIIGHEWVLTAAHCT--------------------YGASYVTISYGAVWRQQPQFTHYDTGNLHN 113
            |:|..:||||||||.                    ||...::::...|      ..||.|.....
Mouse    63 SLIHPQWVLTAAHCVGPHIKSPQLFRVQLREQYLYYGDQLLSLNRIVV------HPHYYTAEGGA 121

  Fly   114 DIAL--IRTPHVDFWSLVNKVELPRYDDRYNNFYGWWALLSGWGS-SSDSSGMTDY-LNCVDIQI 174
            |:||  :..| |:..:.::.:.||...:.:......|  ::|||. .:|......| |..|.:.|
Mouse   122 DVALLELEVP-VNVSTHLHPISLPPASETFPPGTSCW--VTGWGDIDNDEPLPPPYPLKQVKVPI 183

  Fly   175 SDNSVCLDYYGSHYITSNH--------LCYATPENKGSCSGDSGGPLVLHDGNR--QVGIVSFGS 229
            .:||:|...|.:...|.:.        || |....:.||.||||||||......  |.|:||:|.
Mouse   184 VENSLCDRKYHTGLYTGDDFPIVHDGMLC-AGNTRRDSCQGDSGGPLVCKVKGTWLQAGVVSWGE 247

  Fly   230 AAGCLS-NSPKGLTRVTGYLDWI 251
              ||.. |.|...||||.|||||
Mouse   248 --GCAQPNKPGIYTRVTYYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 80/251 (32%)
Tryp_SPc 37..254 CDD:238113 82/252 (33%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 82/252 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.