DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG43742

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:254 Identity:77/254 - (30%)
Similarity:112/254 - (44%) Gaps:64/254 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KINGRITNGYPAYEGKVPYIVALRFDNGNGGGWYCGGSIIGHEWVLTAAHCTYGASYVTISYGAV 96
            ||..|:.||:.|...:  ::.||.    |...::||||:|..::|||||||......||:..|..
  Fly    30 KITYRVANGHTAITSQ--FMAALY----NNSEFFCGGSLIHKQYVLTAAHCVRDLDEVTVHLGEN 88

  Fly    97 WRQ------------------QPQFTHYDTGNLH-NDIALIRTP-HVDFWSLVNKVELPRYDD-- 139
            .|.                  .|.| |   ||:. |||||:|.. .|.|.:.:..:.:...:|  
  Fly    89 NRSCPIPVCKHVLRLNAKVILHPNF-H---GNIFLNDIALLRLEREVIFEAHIRPICIILDEDVT 149

  Fly   140 --RYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDNSVCLDYYGSHYITSNHLCYATPENK 202
              ..|||..:     ||| .::...::|.|:.:|:.....|:|       |...|.:| |...:.
  Fly   150 SNNQNNFTAY-----GWG-KTEHGNISDVLSFIDLVRLPKSMC-------YQNINTIC-AGSTSG 200

  Fly   203 GSCSGDSGGPLV---LHDG-NRQV--GIVSFGSAAGCLSNSPKGL----TRVTGYLDWI 251
            .:|..||||||:   :|.| :|.:  ||.|:|.|. |     .||    |.|..|..||
  Fly   201 DTCESDSGGPLIGNFVHRGKSRDILFGITSYGDAE-C-----SGLFGVYTDVNAYKSWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 73/248 (29%)
Tryp_SPc 37..254 CDD:238113 74/249 (30%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 73/248 (29%)
Tryp_SPc 35..256 CDD:238113 74/249 (30%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435649
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.