DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG43336

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:271 Identity:78/271 - (28%)
Similarity:112/271 - (41%) Gaps:67/271 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DMPAGNKING----RITNGYPAYEGKVPYIVALRFDNGNGGGWYCGGSIIGHEWVLTAAHCTYGA 86
            ||..|.:.:.    |:.||..|.....|:   :.|.:...|.:.||||:|.:..|||||||....
  Fly    23 DMACGIRAHSPSVPRVKNGTVASLTSSPW---MAFLHSTDGRFICGGSLITNRLVLTAAHCFLDR 84

  Fly    87 --------------------SYVTISYGAVWRQQPQFTHYDTGNLHNDIALIRTPHVDFWSLVNK 131
                                ||.|....|:..:..:..||:...:..|||::|        |..|
  Fly    85 TELVARLGEYDREEYEMCHDSYCTYRIEAMVERGFRHRHYNPMTMAYDIAILR--------LYRK 141

  Fly   132 VEL------------PR---YDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDNSVCL 181
            |:.            ||   |.|..:...|     :||| .::|.|.:..|..||:......|| 
  Fly   142 VQYTDNIRPICIVIDPRWRKYIDSLDPLTG-----TGWG-KTESEGDSAKLRTVDLARKHPEVC- 199

  Fly   182 DYYGSHYITSNHLCYATPENKGSCSGDSGGP---LVLHDGNR---QVGIVSFGSAAGCLSNSPKG 240
            ..|.:..:|:|..| |..|....|:||||||   |:.:..::   ||||.||.:.. |:..|.  
  Fly   200 RRYATLSLTANQFC-AGNERSNLCNGDSGGPVGALIPYGKSKRFVQVGIASFTNTQ-CVMVSV-- 260

  Fly   241 LTRVTGYLDWI 251
            .|.|..|:|||
  Fly   261 FTDVMSYVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 73/255 (29%)
Tryp_SPc 37..254 CDD:238113 74/256 (29%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 73/255 (29%)
Tryp_SPc 40..271 CDD:238113 72/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435640
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.