DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG43335

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:267 Identity:73/267 - (27%)
Similarity:110/267 - (41%) Gaps:52/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LERPVPVKDMPAGNKINGRITNGYPAYEGKVPYIVALRFDNGNGGGWYCGGSIIGHEWVLTAAHC 82
            ||....::.||:.::.  ||..|..|.....|::..|.    |...::|.|::|.:::|||||||
  Fly    25 LEPNCGIRTMPSFHRT--RIIGGSDAEITSHPWMAYLY----NEFHYFCAGTLITNQFVLTAAHC 83

  Fly    83 TYGASYVTISYGAVWRQQP-----QFT-------------HYDTGNLHNDIALIRTPH-VDFWSL 128
            ...:..:|:..|.....:.     |.|             ::....:.||||:||... |.|:..
  Fly    84 IEASKNLTVRLGGSGLTRSDGSMCQITAEDYSVSMAIKHKYFTPSIMLNDIAMIRLARTVKFYDH 148

  Fly   129 VN--------KVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDNSVCLDYYG 185
            :.        .|.|...|       |...:.:||| .:|.......|....|.:.:.:||...| 
  Fly   149 IRPICIILDPAVRLLLED-------GMTLMATGWG-LADKRMHPHLLQEAPITVMNRNVCSKLY- 204

  Fly   186 SHYITSNHLCYATPENKGSCSGDSGGPL---VLHDGNR---QVGIVSFGSAAGCLSNSPKGLTRV 244
            ...||...:| |..:...:|.|||||||   |.:.|:.   |.||.|||... |  .||...|.:
  Fly   205 DVAITQGQIC-AGDKETNTCLGDSGGPLGGVVNYYGDLRFVQYGITSFGDIE-C--RSPSIYTDL 265

  Fly   245 TGYLDWI 251
            :.|..||
  Fly   266 STYSGWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 67/247 (27%)
Tryp_SPc 37..254 CDD:238113 68/248 (27%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 67/247 (27%)
Tryp_SPc 42..275 CDD:238113 68/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435634
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.