DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and Ctrl

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_446461.1 Gene:Ctrl / 117184 RGDID:621501 Length:264 Species:Rattus norvegicus


Alignment Length:242 Identity:81/242 - (33%)
Similarity:112/242 - (46%) Gaps:39/242 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 NGRITNGYPAYEGKVPYIVALRFDNGNGGGWYCGGSIIGHEWVLTAAHC--TYGASYVTI-SYGA 95
            |.||.||..|..|..|:.|:|:   .|.|..:||||:|...||:|||||  |.|..:|.: .|..
  Rat    31 NQRIVNGENAVPGSWPWQVSLQ---DNTGFHFCGGSLIAPNWVVTAAHCKVTPGRHFVILGEYDR 92

  Fly    96 VWRQQP--------QFTH--YDTGNLHNDIALIR-------TPHVDFWSLVNKVE-LPRYDDRYN 142
            ....:|        ..||  ::...::||:.|::       |..|....|.:..| ||.      
  Rat    93 SSNAEPIQVLSISKAITHPSWNPNTMNNDLTLLKLASPARYTAQVSPVCLASSNEALPA------ 151

  Fly   143 NFYGWWALLSGWGSSSDSSGMTD-YLNCVDIQISDNSVCLDYYGSHYITSNHLCYATPENKGSCS 206
               |...:.:|||..|....:|. .|..|.:.:...:.|..|:||. ||.:.:| |......||.
  Rat   152 ---GLTCVTTGWGRISGVGNVTPARLQQVVLPLVTVNQCRQYWGSR-ITDSMIC-AGGAGASSCQ 211

  Fly   207 GDSGGPLVLHDGNRQV--GIVSFGSAAGCLSNSPKGLTRVTGYLDWI 251
            ||||||||...||..|  ||||:|: ..|...:|...|||:.:..||
  Rat   212 GDSGGPLVCQKGNTWVLIGIVSWGT-ENCNVQAPAMYTRVSKFNTWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 78/238 (33%)
Tryp_SPc 37..254 CDD:238113 79/239 (33%)
CtrlNP_446461.1 Tryp_SPc 33..257 CDD:214473 78/238 (33%)
Tryp_SPc 34..260 CDD:238113 79/239 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.