DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG42694

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:245 Identity:59/245 - (24%)
Similarity:97/245 - (39%) Gaps:46/245 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LFSAFALVAALERPVPVK--DMPAGNKI-NGRITNGYPAYEGKVPYIVALRFDNGNGGGWYCGGS 69
            ||:...::..|:..|..|  |...|..| |..||.......|.:.:|       .||....|.||
  Fly     4 LFAWLLMLTVLQSHVNSKFLDDYCGAPISNQSITKLRQPQAGWLAHI-------SNGTHVLCSGS 61

  Fly    70 IIGHEWVLTAAHC--TYGASYVTISYGAVWRQQPQFT-------HYDTGNLHNDIALIR-TPHVD 124
            :|..::||:||.|  .:|..:|.:......:....:|       .:....|..||.|:: :..||
  Fly    62 LISKQFVLSAAQCIDVHGKLFVQLGVSNATKSPHWYTVSNVVIPSHSGKRLQRDIGLLKLSQSVD 126

  Fly   125 FWSLV---------NKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDNSVC 180
            :...|         |.:::.:.   ..||     ..|.| .|.:.:..|..|:    |:|.:...
  Fly   127 YNDFVYPICIALNTNTLDMVKI---LQNF-----TTSAW-LSKNKNPQTIVLS----QLSRDRCK 178

  Fly   181 LDYYGSHYITSNHLCYATPENKGSCSGDSGGPLV--LHDGNRQVGIVSFG 228
            |:..|:  :|...:|.|:.:...||..|||..|.  :..|:..|..:.||
  Fly   179 LNLSGN--VTPKEICAASLQRNNSCFIDSGSALTQPIIQGSNIVREMLFG 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 50/214 (23%)
Tryp_SPc 37..254 CDD:238113 50/213 (23%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 47/203 (23%)
Tryp_SPc 46..253 CDD:214473 47/203 (23%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435652
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.