DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and LOC100489516

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_002935402.2 Gene:LOC100489516 / 100489516 -ID:- Length:263 Species:Xenopus tropicalis


Alignment Length:242 Identity:82/242 - (33%)
Similarity:118/242 - (48%) Gaps:44/242 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RITNGYPAYEGKVPYIVALRFDNGNGGGW-YCGGSIIGHEWVLTAAHCTYGAS------------ 87
            ||.||..|..|..|:.|:|:    :...| :||||:|.:|||:|||||  |.|            
 Frog    33 RIVNGEEAVPGSWPWQVSLQ----DSTSWHFCGGSLINNEWVVTAAHC--GVSTRDKVVLGEHDR 91

  Fly    88 ------YVTISYGAVWRQQPQFTH--YDTGNLHNDIALIR--TPHVDFWSLVNKVELPRYDDRYN 142
                  ..:::...|      |||  :::..::|||:||:  ||.| ..:.|..|.|....:.|.
 Frog    92 NSNVEKIQSLAVAKV------FTHPQWNSNTINNDISLIKLATPAV-LGATVAPVCLANIGEDYE 149

  Fly   143 NFYGWWALLSGWGSSSDSSGMT-DYLNCVDIQISDNSVCLDYYGSHYITSNHLCYATPENKGSCS 206
            .  |...:.||||.:..::..| :.|....:.:..|..|..|:|:: ||...:| |......||.
 Frog   150 G--GRICVTSGWGKTRYNAFTTPNLLQQTALPLLTNDQCKSYWGNN-ITGTMIC-AGAAGSSSCM 210

  Fly   207 GDSGGPLV--LHDGNRQVGIVSFGSAAGCLSNSPKGLTRVTGYLDWI 251
            ||||||||  .:|....|||||:||:. |.:|||....|||....|:
 Frog   211 GDSGGPLVCQANDAWTLVGIVSWGSSM-CATNSPGVYARVTVLRSWV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 81/240 (34%)
Tryp_SPc 37..254 CDD:238113 81/241 (34%)
LOC100489516XP_002935402.2 Tryp_SPc 33..256 CDD:214473 81/240 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.