DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and zgc:163079

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:253 Identity:71/253 - (28%)
Similarity:108/253 - (42%) Gaps:38/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 INGRITNGYPAYEGKVPYIVALRFDNGNGGGWYCGGSIIGHEWVLTAA--HCTYGASYVTISYGA 95
            :|.:|..|..|.:|..|:..::......  .:|||||:|...||||.|  .....||.:.:..| 
Zfish    32 LNTKIIGGLNATQGSWPWQASINLKATE--EFYCGGSLINKGWVLTTAKVFALMPASDIVVYLG- 93

  Fly    96 VWRQQPQ---------------FTHYDTGNLHNDIALIR-TPHVDFWSLVNKVELPRYDDRYNNF 144
               :|.|               ..|.:..:|.:::||:: :..|.|...:..|.|......:.:.
Zfish    94 ---RQTQNGSNPYEISRTVTKIIKHPNYNSLDSNLALLKLSSPVTFSDYIKPVCLAAAGSVFVDG 155

  Fly   145 YGWWALLSGWG-----SSSDSSGMTDYLNCVDIQISDNSVCLDYYGSHYITSNHLC--YATPENK 202
            ...|  ::|||     ::.:...:.|.|..|:..|.:|..|...||. .||:..||  |...:.|
Zfish   156 TASW--VTGWGYLNRPATVEEIMLPDVLQEVEAPIVNNFECNAAYGG-IITNKLLCAGYLNEDGK 217

  Fly   203 GSCSGDSGGPLVLHDGN--RQVGIVSFGSAAGCLSNSPKGLTRVTGYLDWIRDHTGIS 258
            ..|:||.|||||:..|.  .|.|:|..|...  |...|....||:.|.|||..:|..|
Zfish   218 APCAGDVGGPLVIKQGAIWIQSGVVVSGYCG--LPGYPTIYVRVSEYEDWISYYTNSS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 66/241 (27%)
Tryp_SPc 37..254 CDD:238113 68/243 (28%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 66/241 (27%)
Tryp_SPc 36..267 CDD:238113 67/241 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.