DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and si:dkey-238d18.3

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001373176.1 Gene:si:dkey-238d18.3 / 795978 ZFINID:ZDB-GENE-131127-38 Length:272 Species:Danio rerio


Alignment Length:239 Identity:78/239 - (32%)
Similarity:122/239 - (51%) Gaps:17/239 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IEGRITNG--KTATSGQFPYQVGLSFASTSGSWWCGGSIIDNTWVLTAAHCTSGASAVTIYYGAT 98
            |:|.|..|  :...:.::|:||  |..::||...||||:|:..||||||||...|.:..:..|..
Zfish    36 IDGDIHEGIMQGVDALRWPWQV--SIKTSSGEHLCGGSLINKFWVLTAAHCQIQARSHYVVLGQH 98

  Fly    99 VRTSAQ-LVQTVSADNFVQHASYN-SIVLRNDISLIKTPTVA-FTALINKVELPAIAGTYSTYT- 159
            .|:|.. .||.......:.|...| ..:..||::|:|..:.| .|:|::.|   .:|.:.|... 
Zfish    99 DRSSNDGTVQVKEIAKVITHPDNNIQTLFNNDVTLLKLSSPAQMTSLVSPV---CLASSSSKIVP 160

  Fly   160 GQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQCQNTYGSLVATNNVICVATPNKVSTCNGDS 224
            |...:.:|||:|....:  |..||.....:||.|||:..:|:...||::|| |..:..|:|.|||
Zfish   161 GTLCVTTGWGRTKTELS--ARILQEATIPIVSQSQCKQIFGASKITNSMIC-AGGSGSSSCQGDS 222

  Fly   225 GGPLVLVSDS--KLIGVTSFVSSAGCESGAPAGFTRVTSYLDWI 266
            ||||:..|..  ..:|:.|: .:..|....|..:.||:.:..||
Zfish   223 GGPLMCESSGVWYQVGIVSW-GNRDCRVDFPLVYARVSYFRKWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 74/234 (32%)
Tryp_SPc 40..269 CDD:238113 76/235 (32%)
si:dkey-238d18.3NP_001373176.1 Tryp_SPc 52..268 CDD:238113 74/223 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.