DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and Prss8

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_579929.1 Gene:Prss8 / 76560 MGIID:1923810 Length:339 Species:Mus musculus


Alignment Length:274 Identity:75/274 - (27%)
Similarity:117/274 - (42%) Gaps:38/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GLLPQQVPIHPRDLPAVTNIEGRITNGKTATSGQFPYQVGLSFASTSGSWWCGGSIIDNTWVLTA 81
            |||...:.....:......|:.|||.|.:|..||:|:||.:::   .|:..||||::.|.||::|
Mouse    22 GLLQSGIRADGTEASCGAVIQPRITGGGSAKPGQWPWQVSITY---DGNHVCGGSLVSNKWVVSA 83

  Fly    82 AHC------------TSGASAVTIYYGATVRTSAQLVQTVSADNFVQHASYNSIVLRNDISLIK- 133
            |||            ..||..:..|...||      |.||:  ..:.|:||.....:.||:||: 
Mouse    84 AHCFPREHSREAYEVKLGAHQLDSYSNDTV------VHTVA--QIITHSSYREEGSQGDIALIRL 140

  Fly   134 TPTVAFTALINKVELPAIAGTYSTYTGQQAIASGWGKTSDSAT-SVANTLQYEVFEVVSVSQCQN 197
            :..|.|:..|..:.|||...::.  .|.....:|||..:.|.: .....||.....::|...|..
Mouse   141 SSPVTFSRYIRPICLPAANASFP--NGLHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETCSC 203

  Fly   198 TYG-------SLVATNNVICVA-TPNKVSTCNGDSGGPLVLVSDS--KLIGVTSFVSSAGCESGA 252
            .|.       ......:::|.. .......|.|||||||....:.  .|.|:.|:..:.|..: .
Mouse   204 LYNINAVPEEPHTIQQDMLCAGYVKGGKDACQGDSGGPLSCPMEGIWYLAGIVSWGDACGAPN-R 267

  Fly   253 PAGFTRVTSYLDWI 266
            |..:|..::|..||
Mouse   268 PGVYTLTSTYASWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 69/250 (28%)
Tryp_SPc 40..269 CDD:238113 70/251 (28%)
Prss8NP_579929.1 Tryp_SPc 45..284 CDD:238113 70/251 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.