DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and Prss41

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_036016678.1 Gene:Prss41 / 71003 MGIID:1918253 Length:353 Species:Mus musculus


Alignment Length:258 Identity:76/258 - (29%)
Similarity:118/258 - (45%) Gaps:46/258 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGKTATSGQFPYQVGLSFASTSGSWWCGGSIIDNTWVLTAAHCTSGASAVTIYYGATVRTSA 103
            ||..|..:..|::|:|..|....   |..||||::...||||||||..       .|....:.:.
Mouse    83 RIVGGIESMQGRWPWQASLRLKK---SHRCGGSLLSRRWVLTAAHCFR-------KYLDPEKWTV 137

  Fly   104 QLVQTVSADNFVQHASYN------SIVLR-------NDISLIKTPTVAFTALINKVELPAIAGTY 155
            ||.|..|..::....:|:      .|::.       :|::|::   :|.:...|| ::..:....
Mouse   138 QLGQLTSKPSYWNRKAYSGRYRVKDIIVNSEDKLKSHDLALLR---LASSVTYNK-DIQPVCVQP 198

  Fly   156 STYTGQ---QAIASGWGKTSDSATSVANTLQYEVFEV-VSV---SQCQNTYG--SL--VATNNVI 209
            ||:|.|   :...:|||...:....:..  .|.:.|| ||:   |:||..:.  ||  :.|.:|.
Mouse   199 STFTSQHQPRCWVTGWGVLQEDLKPLPP--PYHLREVQVSILNNSRCQELFEIFSLHHLITKDVF 261

  Fly   210 CV-ATPNKVSTCNGDSGGPLVLVSDS--KLIGVTSFVSSAGC-ESGAPAGFTRVTSYLDWIKT 268
            |. |......||:||||||||...|.  ..||:.|:  ..|| ....|..:|.|:.|.:||:|
Mouse   262 CAGAEDGSADTCSGDSGGPLVCNMDGLWYQIGIVSW--GIGCGRPNLPGIYTNVSHYYNWIET 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 73/254 (29%)
Tryp_SPc 40..269 CDD:238113 75/257 (29%)
Prss41XP_036016678.1 Tryp_SPc 84..321 CDD:238113 73/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.