DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and Cela3b

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_080695.1 Gene:Cela3b / 67868 MGIID:1915118 Length:269 Species:Mus musculus


Alignment Length:249 Identity:90/249 - (36%)
Similarity:129/249 - (51%) Gaps:24/249 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NIEGRITNGKTATSGQFPYQVGLSFASTSGSW--WCGGSIIDNTWVLTAAHCTSGASAVTIYYGA 97
            |...|:.||:.|....:|:||.|.: ...||:  .||||:|...|||||.||.|.:....:..|.
Mouse    23 NPSSRVVNGEEAVPHSWPWQVSLQY-EKDGSFHHTCGGSLITPDWVLTAGHCISTSRTYQVVLGE 86

  Fly    98 TVR----TSAQLVQTVSADNFVQHASYNSIVLR--NDISLIKTPTVAFTALINKVELPAI--AGT 154
            ..|    ...|::...:.|.|| |..:||:.:.  |||:|:|....|  .|.:.|:|..:  ||.
Mouse    87 HERGVEEGQEQVIPINAGDLFV-HPKWNSMCVSCGNDIALVKLSRSA--QLGDAVQLACLPPAGE 148

  Fly   155 YSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQCQ--NTYGSLVATNNVICVATPNKV 217
            ... .|.....||||:.|.:. .:.:.||..:..||....|.  |.:|..|.| .::| |..:..
Mouse   149 ILP-NGAPCYISGWGRLSTNG-PLPDKLQQALLPVVDYEHCSRWNWWGLSVKT-TMVC-AGGDIQ 209

  Fly   218 STCNGDSGGPLVLVSDS---KLIGVTSFVSSAGCES-GAPAGFTRVTSYLDWIK 267
            |.|||||||||...:|:   ::.||||||||.||.: ..|..||||::::|||:
Mouse   210 SGCNGDSGGPLNCPADNGTWQVHGVTSFVSSLGCNTLRKPTVFTRVSAFIDWIE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 87/242 (36%)
Tryp_SPc 40..269 CDD:238113 88/244 (36%)
Cela3bNP_080695.1 Tryp_SPc 27..262 CDD:214473 87/242 (36%)
Tryp_SPc 28..265 CDD:238113 88/244 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.