DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and Ctrb1

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_079859.2 Gene:Ctrb1 / 66473 MGIID:88559 Length:263 Species:Mus musculus


Alignment Length:269 Identity:93/269 - (34%)
Similarity:139/269 - (51%) Gaps:29/269 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FALALATASAGLLPQQVPIHPRDLPAVTNIEGRITNGKTATSGQFPYQVGLSFASTSGSWWCGGS 71
            |||..||...|:        |...|.:|.: .||.||:.|..|.:|:||.|.  ..:|..:||||
Mouse    10 FALVGATFGCGV--------PAIQPVLTGL-SRIVNGEDAIPGSWPWQVSLQ--DRTGFHFCGGS 63

  Fly    72 IIDNTWVLTAAHCTSGASAVTIYYGATVRTSAQLVQTVSADNFVQHASYNSIVLRNDISLIKTPT 136
            :|...||:|||||....:.|.:.......:..:.||.:......::..:||..:||||:|:|..|
Mouse    64 LISENWVVTAAHCGVKTTDVVVAGEFDQGSDEENVQVLKIAQVFKNPKFNSFTVRNDITLLKLAT 128

  Fly   137 VA-FTALINKVELPAI-----AGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQC 195
            .| |:..::.|.||.:     |||....|       |||||..:|....:.||.....:||.::|
Mouse   129 PAQFSETVSAVCLPTVDDDFPAGTLCATT-------GWGKTKYNALKTPDKLQQAALPIVSEAKC 186

  Fly   196 QNTYGSLVATNNVICVATPNKVSTCNGDSGGPLVLVSDS--KLIGVTSFVSSAGCESGAPAGFTR 258
            :.::||.: |:.:|| |..:.||:|.||||||||...|.  .|.|:.|: .|..|.:..||.:.|
Mouse   187 KESWGSKI-TDVMIC-AGASGVSSCMGDSGGPLVCQKDGVWTLAGIVSW-GSGFCSTSTPAVYAR 248

  Fly   259 VTSYLDWIK 267
            ||:.:.|::
Mouse   249 VTALMPWVQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 83/234 (35%)
Tryp_SPc 40..269 CDD:238113 83/236 (35%)
Ctrb1NP_079859.2 Tryp_SPc 33..256 CDD:214473 83/234 (35%)
Tryp_SPc 34..259 CDD:238113 83/236 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 1 0.950 - 0 Normalized mean entropy S12539
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.