DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and CG18754

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:266 Identity:67/266 - (25%)
Similarity:102/266 - (38%) Gaps:67/266 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGKTATSGQFPYQVGLSFASTSGSWWCGGSIIDNTWVLTAAHCTSGASAVTIYYGATVRTSA 103
            |....:.|...::|:.|.|.:.:..       |:|  .:|||||||..|.   .:.....|..|.
  Fly   105 RDRGAENAELNEYPWMVLLLYENRL-------SLI--RYVLTAAHCVIGG---YLTQNDLVLKSV 157

  Fly   104 QLVQT---------------VSADNFVQHASYNSI--VLRNDISLIKTP-TVAFTALINKV---- 146
            :|.::               |.......|..:.|.  ..||||:|::.. .|.:|..|..:    
  Fly   158 RLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLD 222

  Fly   147 -ELPAIAGTYSTYTGQQAI---ASGWGKTSDSATSVANTLQYEVFEVVSVSQCQNTYGSLVATNN 207
             |.|.           |.:   .|||..|..|.|.:.:|::..     :.:.|.|.|.|..:.:.
  Fly   223 AEFPL-----------QDLNLQISGWDPTKSSQTLITSTVKER-----NPADCLNRYPSFRSASQ 271

  Fly   208 VICVATPNKVSTCNGDSGGPLVLVSDSKLIGVTSFVSSAGCES---------GAPAGFTRVTSYL 263
            | |.....|..||.|.||.|::.:..|   ||..||..||..|         |.|..:|::..:.
  Fly   272 V-CAGGQRKGDTCAGISGSPVMGIMGS---GVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFS 332

  Fly   264 DWIKTN 269
            :|||.|
  Fly   333 EWIKAN 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 63/261 (24%)
Tryp_SPc 40..269 CDD:238113 65/263 (25%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 65/261 (25%)
Tryp_SPc 108..335 CDD:214473 62/258 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436218
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.