DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and CG34171

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:288 Identity:73/288 - (25%)
Similarity:118/288 - (40%) Gaps:52/288 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLVVFALALATASAGLLPQQ---VPIHPRDLPAVTNIEGRITNGKTATSGQFPYQVGLSFASTSG 64
            :|:.:.|.|..|.  :||:.   :.|:....|..:::...:.:.:|.           .:..|.|
  Fly     1 MLLAYFLLLKIAL--VLPKNITTIKINHYHEPTYSHLSSYLVSLRTR-----------KYIHTPG 52

  Fly    65 -SWWCGGSIIDNTWVLTAAHCTSGASAVTIY-YGATVRTSAQLVQTVSADNFVQHASYNSIV--- 124
             :.:|.|.|:.|..|||:|||.:..:.|.:. ....|...|.|.:|..::.||... :|.|:   
  Fly    53 DNHFCTGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFKTPESEEFVVDI-HNMIIHPY 116

  Fly   125 ----LRNDISLIKTPTVAFTALINKVEL------PAIAGTYSTYTGQ--QAIASGWGKTSDSATS 177
                ..|||::||        |...|:|      |.:.|..|...|.  :.|...:|.......|
  Fly   117 YHRNQHNDIAIIK--------LKRYVKLDGHHLAPVVLGNSSLEVGNDCKTIGGIFGVRRQRFGS 173

  Fly   178 VANTLQYEVFEVVSVSQCQNTYGSLVA----TNNVICVATPNKVSTCNGDSGGPLVLVSDSKLIG 238
            ..:.|...| |:....:|.....||:|    ..::|||.:..| ..|..|.|||  |..|.:|.|
  Fly   174 FHSMLLVNV-ELRPFDECLKVKKSLMAARPENEDLICVKSTEK-QMCTTDFGGP--LFCDGQLYG 234

  Fly   239 VTSFVSSAGCESGAPAGFTRVTSYLDWI 266
            :.  :.|..|.|..|..|:.|:.|..|:
  Fly   235 IA--LGSINCSSPDPVFFSDVSFYNSWV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 64/247 (26%)
Tryp_SPc 40..269 CDD:238113 65/248 (26%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 65/256 (25%)
Tryp_SPc 38..263 CDD:304450 65/249 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471236
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.