DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and cela1.4

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001020358.1 Gene:cela1.4 / 574008 ZFINID:ZDB-GENE-050626-127 Length:267 Species:Danio rerio


Alignment Length:281 Identity:91/281 - (32%)
Similarity:140/281 - (49%) Gaps:37/281 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LALATASAGLLPQQVPIHPRDLPAVTNIEGRITNGKTATSGQFPYQVGLSFASTSGSW-WCGGSI 72
            |.|:|.:|..|.:  |.:..||.    ||.|:..|:.|....:|:|:.|.|.|....: .|||::
Zfish     5 LLLSTLAALALAE--PRYLEDLA----IEERVVGGEVAKPNSWPWQISLQFLSALDYFHTCGGTL 63

  Fly    73 IDNTWVLTAAHCTS---------GASAVTIYYGATVRTSAQLVQTVSADNFVQHASYN--SIVLR 126
            |...||||||||..         |...:|.:.|..        |:::......|.::|  |:...
Zfish    64 IRPGWVLTAAHCVDIPRNWRVILGDHDITKHEGHE--------QSLTVSRVYIHPNWNTDSVSSG 120

  Fly   127 NDISLIKTPTVA-FTALINKVELPAIAGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVV 190
            .||:|::..|.| ..:.:....||. ||....:..:..| :|||:| .:..|.::.|:..:..||
Zfish   121 YDIALLQLSTDATLNSYVQLATLPP-AGQVLPHNNECYI-TGWGRT-QTGGSTSSQLKQALLPVV 182

  Fly   191 SVSQCQNT--YGSLVATNNVICVATPNKVSTCNGDSGGPLVLVSDSKLI--GVTSFVSSAGCESG 251
            ..:.|..:  :||:| .:.:|| :...:||.|.|||||||..:.:.|.:  |||||||:|||.:.
Zfish   183 DHNTCSRSDWWGSIV-KDTMIC-SGGGEVSGCQGDSGGPLNCLVNGKYVVHGVTSFVSAAGCNTN 245

  Fly   252 -APAGFTRVTSYLDWIKTNTG 271
             .|..||||::|..||....|
Zfish   246 KKPTVFTRVSAYNSWINAIIG 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 78/244 (32%)
Tryp_SPc 40..269 CDD:238113 79/246 (32%)
cela1.4NP_001020358.1 Tryp_SPc 29..261 CDD:214473 78/244 (32%)
Tryp_SPc 30..264 CDD:238113 79/246 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.