DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and si:dkeyp-93a5.3

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_021326347.1 Gene:si:dkeyp-93a5.3 / 571565 ZFINID:ZDB-GENE-131127-100 Length:328 Species:Danio rerio


Alignment Length:263 Identity:84/263 - (31%)
Similarity:125/263 - (47%) Gaps:48/263 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGKTATSGQFPYQVGLSFASTSGSW--WCGGSIIDNTWVLTAAHC--TSGASAVTIYYG--- 96
            ||..|..||.|.:|:.|.|     .|.:  :||||:|:|.||||||||  ....|::.:|.|   
Zfish    35 RIVGGVNATHGAWPWMVSL-----QGRYGHFCGGSLINNQWVLTAAHCIVDQTPSSIIVYLGKWR 94

  Fly    97 ---ATVRTSAQLVQTVSADNFVQHASYNSIVLRNDISLIK-TPTVAFTALINKVELPAIAGTYST 157
               |.|.:.::.::     :.:.|.||::|...|||:|:: |.||.:|..|..:   .:|...|.
Zfish    95 SYVADVNSISRTIR-----HIIPHPSYSNITKDNDIALLQLTSTVQYTDYIKPI---CLADENSN 151

  Fly   158 Y-TGQQAIASGWGKTS-------DSATSVA------NTLQYEVFEVVSVSQCQN-TYGSLVATNN 207
            : .|..:..:|||...       ...|:|:      ..||....:|.|.:.|.| .:|.:  |.|
Zfish   152 FPRGTNSWVAGWGDIGVLGTGGIRGRTTVSVPLPHPGILQEAELKVYSNADCNNICHGRI--TPN 214

  Fly   208 VICVAT-PNKVSTCNGDSGGPLVLVSDSKLIGVTSFVSSAG---CESGAPAGFTRVTSYLDWIKT 268
            :||..| |...:|.:|||||||:....   :.|.:.|.|.|   .:...|..|.||:.|..||..
Zfish   215 MICAGTRPGGKATFSGDSGGPLMTKCS---VWVQAGVLSHGYGCAQPNLPEVFIRVSEYKQWITG 276

  Fly   269 NTG 271
            |.|
Zfish   277 NVG 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 80/256 (31%)
Tryp_SPc 40..269 CDD:238113 81/258 (31%)
si:dkeyp-93a5.3XP_021326347.1 Tryp_SPc 36..274 CDD:238113 79/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.