DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and ctrl

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001015686.1 Gene:ctrl / 548358 XenbaseID:XB-GENE-5876074 Length:263 Species:Xenopus tropicalis


Alignment Length:244 Identity:80/244 - (32%)
Similarity:134/244 - (54%) Gaps:17/244 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PAVTNI---EGRITNGKTATSGQFPYQVGLSFASTSGSWWCGGSIIDNTWVLTAAHCTSGASAVT 92
            ||::.:   ..||.||:.|..|.:|:||.|.  .::|..:||||:|.:.||:||||| ...:|..
 Frog    22 PAISPVLSGYARIVNGENAVPGSWPWQVSLQ--DSTGFHFCGGSVISDFWVVTAAHC-GVTTAHR 83

  Fly    93 IYYGATVRTS-AQLVQTVSADNFVQHASYNSIVLRNDISLIKTPTVA-FTALINKVELPAIAGTY 155
            :..|...|:| |:.:||.:.....:|.:|||..:.|||:|:|..:.| |:.::..|   .:|.:.
 Frog    84 VILGEYDRSSPAEPIQTKTIAKVFRHPNYNSFTIANDITLLKLSSPASFSNIVAPV---CVASSS 145

  Fly   156 STYT-GQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQCQNTYGSLVATNNVICVATPNKVST 219
            ..:. |::.:.:|||....::....|.||.....::|.::||..:||.: .|.::| |..:..|:
 Frog   146 DAFNGGERCVTTGWGYVDAASRLTPNKLQQVALPLLSNTECQRYWGSKI-LNTMVC-AGASGASS 208

  Fly   220 CNGDSGGPLVLVSDSK--LIGVTSFVSSAGCESGAPAGFTRVTSYLDWI 266
            |.||||||||...:..  |.|:.|:.||. |...:|..:.||::...|:
 Frog   209 CMGDSGGPLVCQRNGAWVLAGIVSWGSST-CSPSSPGVYARVSTLRSWM 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 77/231 (33%)
Tryp_SPc 40..269 CDD:238113 77/232 (33%)
ctrlNP_001015686.1 Tryp_SPc 34..259 CDD:238113 77/232 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.