DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and cela1.6

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001003737.1 Gene:cela1.6 / 445282 ZFINID:ZDB-GENE-040808-55 Length:266 Species:Danio rerio


Alignment Length:283 Identity:89/283 - (31%)
Similarity:142/283 - (50%) Gaps:40/283 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVLVVFAL-ALATASAGLLPQQVPIHPRDLPAVTNIEGRITNGKTATSGQFPYQVGLSFASTSG 64
            :::|::..| |||.|....|.:|:            .:.|:..|:.|....:|:|:.|.:.| .|
Zfish     2 LRILLLSVLAALALAEPRYLEEQI------------AQERVVGGEVARPNSWPWQISLQYLS-GG 53

  Fly    65 SWW--CGGSIIDNTWVLTAAHCTSGASAVTIYYGA-TVRTSAQLVQTVSADNFVQHASY--NSIV 124
            |::  |||::|...:|||||||...:....:..|. .:.......|.::..|...|.::  |::.
Zfish    54 SYYHTCGGTLIKQNFVLTAAHCVDTSRTWRVVLGEHDIYKQEGREQYMTVSNVYIHPNWNRNNVA 118

  Fly   125 LRNDISLIKTPTVAFTALINKVELPAIAGTYSTYTGQ------QAIASGWGKTSDSATSVANTLQ 183
            ...||:|::..:.|  :|...|:|    ||... :||      ....:|||.|| :..|::..|:
Zfish   119 AGYDIALLRLSSNA--SLNTYVQL----GTLPP-SGQVLPHNNACYITGWGLTS-TGGSLSAQLK 175

  Fly   184 YEVFEVVSVSQCQ--NTYGSLVATNNVICVATPNKVSTCNGDSGGPL-VLVSDSKLI-GVTSFVS 244
            .....||..:.|.  :.:||.| .|.::| |....:|.|.||||||| ..||...:: |||||||
Zfish   176 QAYLPVVDYNTCSRGDWWGSTV-KNTMVC-AGGGSLSGCQGDSGGPLNCQVSGQYVVHGVTSFVS 238

  Fly   245 SAGCES-GAPAGFTRVTSYLDWI 266
            |:||.: ..|..||||::|:.||
Zfish   239 SSGCNAYQKPTVFTRVSAYISWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 79/242 (33%)
Tryp_SPc 40..269 CDD:238113 80/243 (33%)
cela1.6NP_001003737.1 Tryp_SPc 30..264 CDD:238113 80/243 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.