DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and CTRB2

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001020371.3 Gene:CTRB2 / 440387 HGNCID:2522 Length:263 Species:Homo sapiens


Alignment Length:274 Identity:89/274 - (32%)
Similarity:138/274 - (50%) Gaps:31/274 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLVVFALALATASAGLLPQQVP-IHPRDLPAVTNIEGRITNGKTATSGQFPYQVGLSFASTSGSW 66
            :|..:||...|...|     || |||     |.:...||.||:.|..|.:|:||.|.  ..:|..
Human     6 LLSCWALLGTTFGCG-----VPAIHP-----VLSGLSRIVNGEDAVPGSWPWQVSLQ--DKTGFH 58

  Fly    67 WCGGSIIDNTWVLTAAHCTSGASAVTIYYGATVRTSAQLVQTVSADNFVQHASYNSIVLRNDISL 131
            :||||:|...||:|||||....|.|.:.......:..:.:|.:......::..::.:.:.|||:|
Human    59 FCGGSLISEDWVVTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNNDITL 123

  Fly   132 IKTPTVA-FTALINKVELPAI-----AGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVV 190
            :|..|.| |:..::.|.||:.     |||....|       |||||..:|....:.||.....::
Human   124 LKLATPARFSQTVSAVCLPSADDDFPAGTLCATT-------GWGKTKYNANKTPDKLQQAALPLL 181

  Fly   191 SVSQCQNTYGSLVATNNVICVATPNKVSTCNGDSGGPLVLVSDS--KLIGVTSFVSSAGCESGAP 253
            |.::|:.::|..: |:.:|| |..:.||:|.||||||||...|.  .|:|:.|: .|..|.:..|
Human   182 SNAECKKSWGRRI-TDVMIC-AGASGVSSCMGDSGGPLVCQKDGAWTLVGIVSW-GSRTCSTTTP 243

  Fly   254 AGFTRVTSYLDWIK 267
            |.:.||...:.|::
Human   244 AVYARVAKLIPWVQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 77/234 (33%)
Tryp_SPc 40..269 CDD:238113 77/236 (33%)
CTRB2NP_001020371.3 Tryp_SPc 33..256 CDD:214473 77/234 (33%)
Tryp_SPc 34..259 CDD:238113 77/236 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.