DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and CG9737

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:273 Identity:78/273 - (28%)
Similarity:112/273 - (41%) Gaps:51/273 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VTNIEGRITNGKTATSGQFPYQVGLSFASTSGSWWCGGSIIDNTWVLTAAHCTSGASAVTIYYGA 97
            |||   ||..|:.|...:||:...|.:  .|..:.|.|::||:..:||||||..|..........
  Fly   146 VTN---RIYGGEIAELDEFPWLALLVY--NSNDYGCSGALIDDRHILTAAHCVQGEGVRDRQGLK 205

  Fly    98 TVRTSAQLVQT----VSADNFVQHA------SYNSIVLR-----------NDISLI--KTPTVAF 139
            .||.....|:|    :...|::..|      :|..|.:.           |||::|  |.| |:|
  Fly   206 HVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHP-VSF 269

  Fly   140 TALINKVELPAIAGTYSTYTGQQAIASGWGKTS---------DSATSVANTLQYEVFEVVSVSQC 195
            |..:..:.||..:...:...||....||||:|.         .|...:...:.|     ||...|
  Fly   270 THFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPY-----VSNENC 329

  Fly   196 QNT---YGSLVATNNVICVATPNKVSTCNGDSGGPLVLV--SDSKLI--GVTSFVSSAGCESGAP 253
            ...   :|..:.... ||........||.|||||||:..  ..|:.:  ||.|:..:....:|.|
  Fly   330 TKILEGFGVRLGPKQ-ICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKP 393

  Fly   254 AGFTRVTSYLDWI 266
            |.:|.|..|.|||
  Fly   394 AVYTNVAEYTDWI 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 73/265 (28%)
Tryp_SPc 40..269 CDD:238113 74/266 (28%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 73/265 (28%)
Tryp_SPc 150..409 CDD:238113 74/266 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.