DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and Jon99Cii

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster


Alignment Length:274 Identity:145/274 - (52%)
Similarity:184/274 - (67%) Gaps:9/274 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVLVVFALALATASAGLLPQQVPIHPRDLPAVTNIEGRITNGKTATSGQFPYQVGLSFASTSGS 65
            ||:.|..|||:|.|:|...|.| .:.|   ..:.:|:||||||..|..|:.||.|||.| |.:|:
  Fly     1 MKLFVFLALAVAAATAVPAPAQ-KLTP---TPIKDIQGRITNGYPAYEGKVPYIVGLLF-SGNGN 60

  Fly    66 WWCGGSIIDNTWVLTAAHCTSGASAVTIYYGATVRTSAQLVQTVSADNFVQHASYNSIVLRNDIS 130
            ||||||||.|||||||||||:|||.|||.|||::||..|....|.:.:.:||..|||..|.||||
  Fly    61 WWCGGSIIGNTWVLTAAHCTNGASGVTINYGASIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDIS 125

  Fly   131 LIKTPTVAFTALINKVELPAIAGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQC 195
            ||:||.|.|.:|:||||||:....|..|.|..|:|||||.|.| .:.:.:.||....:::|.|.|
  Fly   126 LIRTPHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYD-GSPLPDWLQSVDVQIISQSDC 189

  Fly   196 QNTYGSLVATNNVICVATPNKVSTCNGDSGGPLVLVSDSKLIGVTSFVSSAGCESGAPAGFTRVT 260
            ..|:.   ..:|:||:.|....|||.||||||||....::|:|||||.|:|||:|||||.|:|||
  Fly   190 SRTWS---LHDNMICINTDGGKSTCGGDSGGPLVTHDGNRLVGVTSFGSAAGCQSGAPAVFSRVT 251

  Fly   261 SYLDWIKTNTGVSY 274
            .|||||:.|||:||
  Fly   252 GYLDWIRDNTGISY 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 124/226 (55%)
Tryp_SPc 40..269 CDD:238113 125/228 (55%)
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 125/228 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470838
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
1110.900

Return to query results.
Submit another query.