DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and CG11841

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:257 Identity:71/257 - (27%)
Similarity:109/257 - (42%) Gaps:46/257 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ITNGKTATSGQFPYQVGLSFASTSG--SWWCGGSIIDNTWVLTAAHC-TSGASAVTIYYGATVRT 101
            |.:|..|...:||:...|....|:.  .|:|||::|.|..||||||| .|....|.:     ||.
  Fly    72 IVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNV-----VRL 131

  Fly   102 SAQLVQTVSAD---------NFVQHASYNSIVLRNDISLIKTP-TVAFTALINKVELPAIAGTYS 156
            ......|.:.|         ....|..:.:..|.|||.:::.. .|.|    |:.:.||......
  Fly   132 GELEFDTDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKF----NRYKHPACLPFDD 192

  Fly   157 TYTGQQAIASGWGKTSDSATSVANTLQYE--------VFEVVSVSQCQNTYGSLVATNNVICVAT 213
            ....:..||.|||:...:.......|:.:        |..|.:..:..|.|    ...:.:|:.:
  Fly   193 GEQHESFIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDANDELPNGY----EPKSQLCIGS 253

  Fly   214 PNKVSTCNGDSGGPLV-----LVSDSKLIGVTSFVSSAG--CES-GAPAGFTRVTSYLDWIK 267
            .:...|||||||||::     |.....::|:|    |||  |.: ..|:.:|||..:|:|||
  Fly   254 RDNKDTCNGDSGGPVLAYHKDLACMYHVMGIT----SAGITCSTPDIPSAYTRVHYFLNWIK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 68/254 (27%)
Tryp_SPc 40..269 CDD:238113 71/257 (28%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 69/255 (27%)
Tryp_SPc 72..310 CDD:214473 68/254 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437153
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.