DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and CG16710

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:269 Identity:76/269 - (28%)
Similarity:110/269 - (40%) Gaps:46/269 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGKTATSGQFPYQVGLSFASTSGSWW-------CGGSIIDNTWVLTAAHC------------ 84
            ||..|:.....:.|:...:.:|..|.|.|       |.||:|.|.:|||||||            
  Fly   105 RIFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNRYVLTAAHCLRITGLDLRRVR 169

  Fly    85 ------TSGASAVTIYYGATVRTSAQLVQTVSADNFVQHASYNSIVLR--NDISL--IKTPTVAF 139
                  .|....||...|........|  .:..|..::|..|.....|  |||:|  :|.| |.:
  Fly   170 LGEHNILSNPDCVTHINGREHCAPEHL--EIDVDLSIKHRHYMVFEERPYNDIALLRLKFP-VRY 231

  Fly   140 TALINK--VELPAIAGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQCQNTYGSL 202
            ||.|..  |:|..|....| ::..:...:|||.:.....|  |.|........:..:|..:..||
  Fly   232 TAQIKPICVQLDYIFSNPS-FSNHKLQIAGWGLSHKQGYS--NVLLQAYVNGRNADECSLSEPSL 293

  Fly   203 -VATNNVICVATPNKVSTCNGDSGGPLVLVSDS------KLIGVTSFVSSAGCESGAPAGFTRVT 260
             :.....||........||.|||||||:.:.:.      .|.|:||:..|. |..| ||.:|:.:
  Fly   294 GLDKETHICAGNLGGNDTCKGDSGGPLMAIMERGDEEFVYLAGITSYGYSQ-CGYG-PAAYTKTS 356

  Fly   261 SYLDWIKTN 269
            .:::||..|
  Fly   357 KFVEWILWN 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 73/264 (28%)
Tryp_SPc 40..269 CDD:238113 74/266 (28%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 73/264 (28%)
Tryp_SPc 106..362 CDD:238113 72/263 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436221
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.