DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and CG31219

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:275 Identity:74/275 - (26%)
Similarity:122/275 - (44%) Gaps:45/275 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LPAVTNIEG------RITNGKTATSGQFPYQVGLSFASTSGSW---WCGGSIIDNTWVLTAAHCT 85
            ||: |.|.|      |:..|..|....:|:...|.:.:|:...   :|.||:|:|.:|||:|||.
  Fly    74 LPS-TEICGQSLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCV 137

  Fly    86 SG----ASAVTIYYGATVRT---------------SAQLVQTVSADNFVQHASYNSIVLRN---D 128
            :|    .|..::..|....|               .|.....:..:..:.|..::||..||   |
  Fly   138 NGIPRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYD 202

  Fly   129 ISL--IKTPTVAFTALINKVELPAIAGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVS 191
            |:|  :|.|....|.:     :|.....:..:...:...:|||||::...|  ..|.:......|
  Fly   203 IALLRLKMPVRYRTGI-----MPICIPKHGFFAKSKLEIAGWGKTNEGQFS--QVLMHGFIRERS 260

  Fly   192 VSQCQNTYGSLVATNNV-ICVATPNKVSTCNGDSGGPLVLVSDSK---LIGVTSFVSSAGCESGA 252
            ::.|...:..|....:: ||....:.|.||.|||||||::..|:.   |.|:|::.|....:.|.
  Fly   261 IAVCALRFPYLDLNQSLQICAGGYDGVDTCQGDSGGPLMVTMDNSSVYLAGITTYGSKNCGQIGI 325

  Fly   253 PAGFTRVTSYLDWIK 267
            |..:||.:::|.|||
  Fly   326 PGIYTRTSAFLPWIK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 66/257 (26%)
Tryp_SPc 40..269 CDD:238113 68/259 (26%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 66/257 (26%)
Tryp_SPc 90..342 CDD:238113 68/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436219
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.