DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and CG5255

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:278 Identity:87/278 - (31%)
Similarity:129/278 - (46%) Gaps:30/278 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLVVFALALATASAGLLPQQVPIHPRDLPAVTNIEGRITNGKTATSGQFPYQVGLSFASTSGSWW 67
            :|::..|.|.|:||.   .|: ::|   |..|  :.||..|:.|.:|..|||:.|. ...||:..
  Fly     2 LLILLPLVLFTSSAA---SQI-LYP---PQYT--KNRIVGGEEAAAGLAPYQISLQ-GIGSGAHS 56

  Fly    68 CGGSIIDNTWVLTAAHCTSGASAVTIYYGATVRTSAQ-LVQTVS----ADNFVQHASYNSIVLRN 127
            |||:|||..|::||||||.|..|...    .|.|..| |.|..|    .|..|:|::|.....||
  Fly    57 CGGAIIDERWIITAAHCTRGRQATAF----RVLTGTQDLHQNGSKYYYPDRIVEHSNYAPRKYRN 117

  Fly   128 DISLIK-TPTVAFTALINKVELPAIAGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVS 191
            ||:|:. ..::.|......|||...|    ...|.:.:.:|||..|......|.....|| ..|.
  Fly   118 DIALLHLNESIVFDNATQPVELDHEA----LVPGSRLLLTGWGTLSLGGDVPARLQSLEV-NYVP 177

  Fly   192 VSQCQNTYGSLVATN-NVICVATPNKVSTCNGDSGGPLVLVSDSKLIGVTSFVSSAGCESGAPAG 255
            ..||:..:.:....: ..:|.........|:||||||  ||.:.||:.:.::  ...|..|.|..
  Fly   178 FEQCRAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGP--LVHNGKLVALVNW--GLPCAKGYPDA 238

  Fly   256 FTRVTSYLDWIKTNTGVS 273
            ...::.|.|:|:|:..:|
  Fly   239 HASISYYHDFIRTHLSLS 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 74/233 (32%)
Tryp_SPc 40..269 CDD:238113 74/235 (31%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 74/233 (32%)
Tryp_SPc 30..252 CDD:238113 74/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436863
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.