DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and CG17475

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:248 Identity:79/248 - (31%)
Similarity:104/248 - (41%) Gaps:37/248 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NIEGRITNGKTATSGQFPYQVGLSFASTSGSWWCGGSIIDNTWVLTAAHCTSGASAVTIYYGAT- 98
            |.:.|:.||:....|:..||:.|.  ...|...|||.|||...|||||||..|       |..| 
  Fly    45 NFQNRVINGEDVQLGEAKYQISLQ--GMYGGHICGGCIIDERHVLTAAHCVYG-------YNPTY 100

  Fly    99 --VRTSAQLVQTVSADNFVQ----HASYNSIVLRNDISLIK-TPTVAFTALINKVELPAIAGTYS 156
              |.|.....:...|..||:    |.:|||....|||:||: ..|:.|.......|||    |..
  Fly   101 LRVITGTVEYEKPDAVYFVEEHWIHCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELP----TAP 161

  Fly   157 TYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQCQNTYGSLVATNNV------ICVATPN 215
            ...|.|.:.:|||.| :......:.||......|..|.||.     :..|:.      ||..|..
  Fly   162 VANGTQLLLTGWGST-ELWGDTPDILQKAYLTHVVYSTCQE-----IMNNDPSNGPCHICTLTTG 220

  Fly   216 KVSTCNGDSGGPLVLVSDSKLIGVTSFVSSAGCESGAPAGFTRVTSYLDWIKT 268
            ....|:||||||  |..:..|.|:.::  ...|..|.|.....|..||:||::
  Fly   221 GQGACHGDSGGP--LTHNGVLYGLVNW--GYPCALGVPDSHANVYYYLEWIRS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 76/240 (32%)
Tryp_SPc 40..269 CDD:238113 77/243 (32%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 76/240 (32%)
Tryp_SPc 50..269 CDD:238113 77/241 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436864
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.