DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and CG17477

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:240 Identity:76/240 - (31%)
Similarity:113/240 - (47%) Gaps:22/240 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IEGRITNGKTATSGQFPYQVGLSFASTSGSWWCGGSIIDNTWVLTAAHCTSG--ASAVTIYYGAT 98
            :|..|..|:.|..|..||||.|.  :..||..|||:||.:.|::||.||..|  .|.:.:..| |
  Fly    23 LEHFIVGGQNAAEGDAPYQVSLQ--TLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATG-T 84

  Fly    99 VRTSAQLVQTVSADNFVQHASYNSIVLRNDISLIK-TPTVAFTALINKVELPAIAGTYSTYT--G 160
            :| .|:.......|....|.:|:|...:|||.|:. ..::.|.||...||||.     |.:.  .
  Fly    85 IR-YAEPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPT-----SPFPRGA 143

  Fly   161 QQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQCQ---NTYGSLVATNNVICVATPNKVSTCNG 222
            .:.:.:|||..| :|.|:.:.||....:.::...|:   :.|..|......||......:..|:|
  Fly   144 SELVFTGWGSQS-AAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHG 207

  Fly   223 DSGGPLVLVSDSKLIGVTSFVSSAGCESGAPAGFTRVTSYLDWIK 267
            |||||  ||....|:|:.:|.  ..|..|.|..|..:..|.||::
  Fly   208 DSGGP--LVHQGTLVGILNFF--VPCAQGVPDIFMNIMYYRDWMR 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 74/234 (32%)
Tryp_SPc 40..269 CDD:238113 75/236 (32%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 75/236 (32%)
Tryp_SPc 27..246 CDD:214473 73/232 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.