DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and CG8870

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:270 Identity:72/270 - (26%)
Similarity:116/270 - (42%) Gaps:57/270 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 TNGKTATSGQFPYQVGLSFASTSGSWW-----CGGSIIDNTWVLTAAHCTSGASAVTIYYGATVR 100
            |.||.....:||:...|.:.:.:....     ||||:|:|.:|||||||.........|...|||
  Fly    85 TKGKIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFMDYPYALKTVR 149

  Fly   101 -----TS--------------AQLVQTVSADNFVQHASYN-SIVLRNDISLI--KTPTVAFTALI 143
                 ||              |.|...:..|..:.|..:| ...|.|||:|:  |.| |.:|..|
  Fly   150 LGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLINDIALVRLKFP-VRYTRAI 213

  Fly   144 NKVELPAIAGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQ-----CQNTYGSLV 203
            ..:.||. |...:.:. ::..||||   .|....:|:.:....|    :::     |::.|...:
  Fly   214 QPICLPR-AQKLAAHK-RKFQASGW---PDMGQGIASEVLLRSF----IAERHPDVCKSNYDFNL 269

  Fly   204 ATNNVICVATPNKVSTCNGDSGGPLVLVSDSKLIGVTSFVSSAG--------C--ESGAPAGFTR 258
            .:.  ||....:...|..|||||||:   ::.:.|..:...:||        |  ::..||.:|:
  Fly   270 GSQ--ICAGGLDGNDTSPGDSGGPLM---ETVIRGKVTLTYAAGIISYGQKPCVLKTCKPAFYTK 329

  Fly   259 VTSYLDWIKT 268
            .:.:.:|||:
  Fly   330 TSYFFEWIKS 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 69/266 (26%)
Tryp_SPc 40..269 CDD:238113 72/270 (27%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 69/262 (26%)
Tryp_SPc 93..337 CDD:214473 66/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436223
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.