DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and CG13318

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:242 Identity:68/242 - (28%)
Similarity:115/242 - (47%) Gaps:28/242 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ATSGQFPYQVGLSFASTSGSWWCGGSIIDNTWVLTAAH--CTSGASAVTIYYGA--TVRTSAQL- 105
            |:.|.:|:|..|  .:|:..:..||::|....||||||  ...|.:...:..|.  ...||..: 
  Fly   169 ASFGAYPWQAAL--LTTADVYLGGGALITAQHVLTAAHKVYNLGLTYFKVRLGEWDAASTSEPIP 231

  Fly   106 VQTVSADNFVQHASYNSIVLRNDISLIKTPT-VAFT--ALINKVELPAIAGTYSTYTGQQAIASG 167
            .|.|...|...:.|:|...|:||::::|..| |:.|  :.:..|.||.     :::.||:...:|
  Fly   232 AQDVYISNVYVNPSFNPNNLQNDVAILKLSTPVSLTSKSTVGTVCLPT-----TSFVGQRCWVAG 291

  Fly   168 WGKTSDSATSVANTLQYEV-FEVVSVSQCQ-----NTYGS--LVATNNVICVATPNKVSTCNGDS 224
            |||....||.....::.:| ..::..:.||     ...||  :::..:.||.........|.||.
  Fly   292 WGKNDFGATGAYQAIERQVDVPLIPNANCQAALQATRLGSSFVLSPTSFICAGGEAGKDACTGDG 356

  Fly   225 GGPLVLVSDS--KLIGVTSFVSSAGC-ESGAPAGFTRVTSYLDWIKT 268
            |.|||..|:.  .::|:.::  ..|| ::|.|..:..|.:||.||:|
  Fly   357 GSPLVCTSNGVWYVVGLVAW--GIGCAQAGVPGVYVNVGTYLPWIQT 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 65/238 (27%)
Tryp_SPc 40..269 CDD:238113 68/242 (28%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 68/242 (28%)
Tryp_SPc 169..399 CDD:214473 65/238 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435436
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.