DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and CG14088

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:223 Identity:44/223 - (19%)
Similarity:79/223 - (35%) Gaps:41/223 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 GSIIDNTWVLTAAHCTSGASAVTIYYGATVRTSAQLVQTVSADNFVQHASYNSIVLRNDISLIK- 133
            |::|...::||..||......:....|...|..::|.:......|..:|::|.....|::.|:| 
  Fly    60 GTLIHERFILTDVHCGDSIGVIRARLGEYGRIGSELAEDHIVAAFFSNANFNPETQANNMGLMKL 124

  Fly   134 TPTVAF------TALINKVELPAIAGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSV 192
            ..||.:      ..::....:...|.....:.|     :.| |.||.:..:.:.         :|
  Fly   125 LRTVVYKEHIIPVCILMDSRMQTFADELDYFNG-----TTW-KNSDKSPMLRSK---------TV 174

  Fly   193 SQCQNTYGSLVATNNVICVATPNKVSTCNGDSGGPLVLVSD------SKLIGVTSFVSSAGCESG 251
            .:.....|.|  .:...| |....:.:|:..||..|....|      :.|.|:.:.| ...|.:.
  Fly   175 IRMPQACGKL--DHGQFC-AGHKDLDSCDEPSGAALTREIDYIGPNRTVLFGIANSV-EVKCSNS 235

  Fly   252 APAGFTRVTSYLDWI-------KTNTGV 272
            ..  :|.|.....||       .||.|:
  Fly   236 RT--YTDVVQLHQWISMVIYSSNTNDGM 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 39/208 (19%)
Tryp_SPc 40..269 CDD:238113 41/218 (19%)
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 41/211 (19%)
Tryp_SPc 42..248 CDD:214473 39/208 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.