DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and CG18223

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:217 Identity:52/217 - (23%)
Similarity:88/217 - (40%) Gaps:31/217 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 WCGGSIIDNTWVLTAAHCTSGASAVTIYYGATVRTSAQLVQTVSADNFVQ-------HASYNSIV 124
            :|||.||..|::||:|||......:       |..|..||......|.::       :.....|.
  Fly    78 FCGGVIISRTYILTSAHCAMDKRKI-------VHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIF 135

  Fly   125 LRNDISLIKTPTVAFTALINKVELP-AIAGTYSTYT-----GQQAIASGWGKTSDSATSVANTLQ 183
            :.:..::..|..:|...|..|:.|. .:.|..:..|     |......|||:........::.|.
  Fly   136 VPDKFTVFNTNNIALMMLAKKLPLDNPLVGVINLPTADPEPGLNYTVLGWGRIFKGGPLASDILH 200

  Fly   184 YEVFEVVSVSQCQNTYGSLVATNNVICVATPNKV---STCNGDSGGPLVLVSDSKLIGVTSFVSS 245
            .:| |::....|:....  :....::|....|..   :.|.||:|.||:.  :..:.||.|:  .
  Fly   201 IDV-ELLPRDICEKKVH--IFKEEMMCAGNLNNTMDENPCAGDTGSPLIF--NETVFGVVSY--R 258

  Fly   246 AGCESGA-PAGFTRVTSYLDWI 266
            .||.|.. |:.:|.|..::|||
  Fly   259 VGCGSKTLPSIYTNVYMHMDWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 50/215 (23%)
Tryp_SPc 40..269 CDD:238113 52/217 (24%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 52/217 (24%)
Tryp_SPc 60..280 CDD:214473 50/215 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436861
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.