DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and ctrb1

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_002944677.2 Gene:ctrb1 / 394984 XenbaseID:XB-GENE-977509 Length:263 Species:Xenopus tropicalis


Alignment Length:278 Identity:96/278 - (34%)
Similarity:138/278 - (49%) Gaps:43/278 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VVFALALATASAGLLPQQVPIHPRDLPAVTNIEGRITNGKTATSGQFPYQVGLSFASTSGSW-WC 68
            :|..|||||...|....|:      .|.||.. .||.||:.|..|.:|:||.|   ..|.|| :|
 Frog     6 LVSCLALATTVYGCGQPQI------APVVTGY-ARIVNGEEAVPGSWPWQVSL---QDSTSWHFC 60

  Fly    69 GGSIIDNTWVLTAAHCTSGASAVTIYYGATVR-----------TSAQLVQTVSADNFVQHASYNS 122
            |||:|:|.||:|||||           |.:.|           ::.:.:|:::......|..:||
 Frog    61 GGSLINNEWVVTAAHC-----------GVSTRDKVVLGEHDRGSNVEKIQSLAVAKVFTHPQWNS 114

  Fly   123 IVLRNDISLIK--TPTVAFTALINKVELPAIAGTYSTYTGQQAIASGWGKTSDSATSVANTLQYE 185
            ..:.|||||||  ||.| ..|.:..|.|..|...|.  .|:..:.||||||..:|.:..|.||..
 Frog   115 NTINNDISLIKLATPAV-IGATVAPVCLANIGEDYE--GGRICVTSGWGKTRYNAFTTPNQLQQT 176

  Fly   186 VFEVVSVSQCQNTYGSLVATNNVICVATPNKVSTCNGDSGGPLVLVSDS--KLIGVTSFVSSAGC 248
            ...:::..||::.:|:.: |..:||...... |:|.||||||||..::.  .|:|:.|:.||. |
 Frog   177 ALPLLTNDQCKSYWGNNI-TGTMICAGAAGS-SSCMGDSGGPLVCQANDAWTLVGIVSWGSSM-C 238

  Fly   249 ESGAPAGFTRVTSYLDWI 266
            .:..||.:.||.....|:
 Frog   239 STSTPAVYARVAVLRSWV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 84/242 (35%)
Tryp_SPc 40..269 CDD:238113 84/243 (35%)
ctrb1XP_002944677.2 Tryp_SPc 33..256 CDD:214473 84/242 (35%)
Tryp_SPc 34..259 CDD:238113 84/243 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.