DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and CG18180

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:274 Identity:111/274 - (40%)
Similarity:151/274 - (55%) Gaps:27/274 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ALALATASAGLLPQQVPIHPRDLPAVT----NIEGRITNGKTATSGQFPYQVGLSFASTSGS--- 65
            ||||..||           |..|...|    ..||||.||..|..|:.||.||| |..|.||   
  Fly    11 ALALVAAS-----------PTGLNRTTLLSQGAEGRIVNGYPAPEGKAPYIVGL-FIRTDGSNSG 63

  Fly    66 WWCGGSIIDNTWVLTAAHCTSGASAVTIYYGATVRTSAQLVQTVSADNFVQHASYNSIVLRNDIS 130
            ....|:||.|.|:||||||.:| ..|.|:||:....:....|||..|||:.|..:.|...| ||.
  Fly    64 AVGAGTIIANDWILTAAHCLTG-DYVEIHYGSNWGWNGAYRQTVRRDNFISHPDWPSQGGR-DIG 126

  Fly   131 LIKTPTVAFTALINKVELPAIAGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQC 195
            ||:||.|.|..||||:.||::......|.....:|.|||...:.  ::|:.||....:::|.|:|
  Fly   127 LIRTPHVDFNGLINKIPLPSMNEQNDRYQDTWCVACGWGGMDNG--NLADWLQCVDVQIISNSEC 189

  Fly   196 QNTYGSLVATNNVICVATPNKVSTCNGDSGGPLVLVSDSKLIGVTSFVSSAGCESGAPAGFTRVT 260
            :..|||:.:|:  :|....:..|.|.||||||||...:::|:||.:| :|..|..| |:|:|||:
  Fly   190 EQAYGSVASTD--MCTRHADGKSVCGGDSGGPLVTHDNARLVGVITF-ASVSCHDG-PSGYTRVS 250

  Fly   261 SYLDWIKTNTGVSY 274
            .||:||:..||:||
  Fly   251 DYLEWIRDQTGISY 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 94/229 (41%)
Tryp_SPc 40..269 CDD:238113 95/231 (41%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 94/229 (41%)
Tryp_SPc 36..259 CDD:238113 95/231 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470835
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.