DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and CG18179

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:288 Identity:114/288 - (39%)
Similarity:163/288 - (56%) Gaps:34/288 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVLVV---FALALATASAG-----LLPQQVPIHPRDLPAVT---NIEGRITNGKTATSGQFPYQ 54
            ||:.::   .|||:..||.|     ||||           ||   ..||||.||..|..|:.||.
  Fly     1 MKLFLLTLSVALAVVAASPGFNRTSLLPQ-----------VTISEGAEGRIVNGYPAPEGKAPYI 54

  Fly    55 VGLSFASTSGSWWC---GGSIIDNTWVLTAAHCTSGASAVTIYYGATVRTSAQLVQTVSADNFVQ 116
            ||| ...|.||...   .|:||.:.|:||||||.: ...|.|:||:....:....|:|..|||:.
  Fly    55 VGL-LIRTDGSNSAAVGAGTIIASDWILTAAHCLT-TDYVEIHYGSNWGWNGAFRQSVRRDNFIS 117

  Fly   117 HASYNSIVLRNDISLIKTPTVAFTALINKVELPAIAGTYSTYTGQQAIASGWGKTSDSATSVANT 181
            |.::.:...| ||.||:||:|.||.|||||.||:.:.....:.....:|.|||...:.  ::|:.
  Fly   118 HPNWPAEGGR-DIGLIRTPSVGFTDLINKVALPSFSEESDRFVDTWCVACGWGGMDNG--NLADW 179

  Fly   182 LQYEVFEVVSVSQCQNTYGSLVATNNVICVATPNKVSTCNGDSGGPLVLVSDSKLIGVTSFVSSA 246
            ||....:::|.|:|:.:||::.:|:  :|....:..|:|.||||||||...:::|:||.:| .|.
  Fly   180 LQCMDVQIISNSECEQSYGTVASTD--MCTRRTDGKSSCGGDSGGPLVTHDNARLVGVITF-GSV 241

  Fly   247 GCESGAPAGFTRVTSYLDWIKTNTGVSY 274
            .|.|| |:|:||||.||.||:.|||:||
  Fly   242 DCHSG-PSGYTRVTDYLGWIRDNTGISY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 91/229 (40%)
Tryp_SPc 40..269 CDD:238113 92/231 (40%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 91/229 (40%)
Tryp_SPc 40..263 CDD:238113 92/231 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470847
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.