DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and CG3088

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:278 Identity:106/278 - (38%)
Similarity:155/278 - (55%) Gaps:30/278 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVLVVF-ALALATASAGLLPQQVPIHPRDLPAVTNIEGRITNGKTATSGQFPYQVGLSFASTSG 64
            ||:|||| .|.|..|.:.....:.|.|            .||||..|..||.||.||::|..:  
  Fly     1 MKLLVVFLGLTLVAAGSAKKDSEDPDH------------IITNGSPAYEGQAPYVVGMAFGQS-- 51

  Fly    65 SWWCGGSIIDNTWVLTAAHCTSGASAVTIYYGATVRTSAQLVQTVSADNFV---QHASYNSIVLR 126
            :.||.|:||.:||:||:|.|.:|:|.||||:|||..:.||...||....:|   ||         
  Fly    52 NIWCSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQAQFTVTVGTSEYVTGNQH--------- 107

  Fly   127 NDISLIKTPTVAFTALINKVELPAIAGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVS 191
              ::|::.|.|.|:..:|:|.||::......|....|...|||.|:.| ..:.:.||....:::|
  Fly   108 --LALVRVPRVGFSNRVNRVALPSLRNRSQRYENWWANVCGWGVTTFS-NGLTDALQCVDLQIMS 169

  Fly   192 VSQCQNTYGSLVATNNVICVATPNKVSTCNGDSGGPLVLVSDSKLIGVTSFVSSAGCESGAPAGF 256
            .::|...|||...::.::|..||:..|||.||:|.||:...||.::|:::||:|.||..|.||||
  Fly   170 NNECIAFYGSTTVSDQILCTRTPSGRSTCFGDAGSPLITKQDSTVVGISAFVASNGCTLGLPAGF 234

  Fly   257 TRVTSYLDWIKTNTGVSY 274
            .|:||.||||...||::|
  Fly   235 ARITSALDWIHQRTGIAY 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 90/229 (39%)
Tryp_SPc 40..269 CDD:238113 92/231 (40%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 92/230 (40%)
Tryp_SPc 29..244 CDD:214473 90/228 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470850
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.